|
Catalog # |
Quantity |
Price |
|
P1019 |
250 unit |
$560 |
|
Alternative name |
ULP1, SUMO Protease
|
|
Description |
Ulp (recombinant S.cerevisiae ULP1fragment) is also known as SUMO Protease, which recognizes SUMO protein in a highly specific manner. Ulp is widely used to cleave SUMO from recombinant fusion protein. The protein is stable at wide temperature range (4-37°C) and at pH 7-9. The recommending temperature for cleavage is 30°C. Ulp is purified from E.coli with a N-terminal His tag. It can be removed easily after cleavage.
|
|
Uniprot number |
Q02724 |
|
Expressed in |
E.coli |
|
Sequence |
GSHHHHHHLVPELNEKDDDQVQKALASRENTQLMNRDNIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDCGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK
|
|
Molecular Weight |
26.4 kDa |
|
Storage |
6 months at -80°C from date of shipment. Please avoid freeze-thaw cycles.
|
|
Appearance |
10x high concentration stock solution |
|
Formulation |
Supplied as 10x high concentration solution in 500 mM Tris-HCl, pH 8.0 2% NP-40, 1.5 M NaCl, 10 mM DTT |
|
Purity |
≥95%, determined by SDS-PAGE |
|
Note |
For laboratory research only. Not for clinical applications. For technical questions, please email us at support@cellron.com. For bulk order, please contact sales@cellron.com.
|